General Information

  • ID:  hor006808
  • Uniprot ID:  A8CEM5
  • Protein name:  Agouti-signaling protein
  • Gene name:  ASIP
  • Organism:  Macaca hecki
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Macaca (macaques); Macaca hecki (Heck's macaque)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0005184 neuropeptide hormone activity; GO:0031779 melanocortin receptor binding
  • GO CC:  GO:0048023 positive regulation of melanin biosynthetic process; GO:0032438 melanosome organization; GO:0042438 melanin biosynthetic process; GO:0009755 hormone-mediated signaling pathway

Sequence Information

  • Sequence:  PPPEEKLRDDRSLRSNSSVNLLDFPSVSIVALNKNSKQISRKEAEKKRSSKKEASMKKVARPRTPLSAPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLSLNC
  • Length:  109
  • Propeptide:  MDVTRLLLATLLVFLCFFTAYSHPPPEEKLRDDRSLRSNSSVNLLDFPSVSIVALNKNSKQISRKEAEKKRSSKKEASMKKVARPRTPLSAPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLSLNC
  • Signal peptide:  MDVTRLLLATLLVFLCFFTAYS
  • Modification:  T113 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment)
  • Mechanism:  The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment)
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA